Structure of PDB 4ydx Chain A

Receptor sequence
>4ydxA (length=67) Species: 9606 (Homo sapiens) [Search protein sequence]
PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTL
LATLKKTGKTVSYLGLE
3D structure
PDB4ydx Crystallography and chemistry should always go together: a cautionary tale of protein complexes with cisplatin and carboplatin.
ChainA
Resolution1.602 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PT A T11 C12 C15 T10 C11 C14
BS02 TCE A C12 C15 K60 C11 C14 K59
Gene Ontology
Molecular Function
GO:0005507 copper ion binding
GO:0005515 protein binding
GO:0016530 metallochaperone activity
GO:0016531 copper chaperone activity
GO:0032767 copper-dependent protein binding
GO:0046872 metal ion binding
GO:1903136 cuprous ion binding
Biological Process
GO:0006825 copper ion transport
GO:0006878 intracellular copper ion homeostasis
GO:0006979 response to oxidative stress
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ydx, PDBe:4ydx, PDBj:4ydx
PDBsum4ydx
PubMed26327386
UniProtO00244|ATOX1_HUMAN Copper transport protein ATOX1 (Gene Name=ATOX1)

[Back to BioLiP]