Structure of PDB 4ydn Chain A

Receptor sequence

>4ydnA (length=116) Species: 9606 (Homo sapiens)

CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT
TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAA
LLSPYSYSTTAVVTNP

3D structure

• PDB: 4ydn A Fluorogenic Aryl Fluorosulfate for Intraorganellar Transthyretin Imaging in Living Cells and in Caenorhabditis elegans.
• Chain: A
• Resolution: 1.35 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	2WN	A	X15 A108 L110 S117 T118	X6 A99 L101 S108 T109	PDBbind-CN: -logKd/Ki=8.64,Kd=2.3nM
BS02	4B8	A	X15 A108 L110 S117	X6 A99 L101 S108

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0070324 thyroid hormone binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0035578 azurophil granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:4ydn, PDBe:4ydn, PDBj:4ydn
• PDBsum: 4ydn
• PubMed: 26051248
• UniProt: P02766|TTHY_HUMAN Transthyretin (Gene Name=TTR)