Structure of PDB 4ycx Chain A

Receptor sequence

>4ycxA (length=331) Species: 9606 (Homo sapiens)

WMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVL
KALPSPVTTLSQLQGLPHFGEHSSRVVQELLEHGVCEEVERVRRSERYQT
MKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDL
STPVLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLIT
HPKEGQEAGLLPRVMCRLQDQGLILYHQHQHSAFERSFCIFRLPQPGSWK
AVRVDLVVAPVSQFPFALLGWTGSKLFQRELRRFSRKEKGLWLNSHGLFD
PEQKTFFQAASEEDIFRHLGLEYLPPEQRNA

3D structure

• PDB: 4ycx Creative template-dependent synthesis by human polymerase mu.
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D330 D332 D418
• Catalytic site (residue number reindexed from 1): D194 D196 D255
• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	L177 H365 Q366 H367 A384 R442 R445 R449 K450 N457	L41 H229 Q230 H231 A233 R279 R282 R286 K287 N294
BS02	dna	A	F244 G245 V246 G247 T250 Q275 F389 R416 W434	F108 G109 V110 G111 T114 Q139 F238 R253 W271
BS03	dna	A	G174 R175 T178 H204 G206 H208 S209	G38 R39 T42 H68 G70 H72 S73
BS04	MG	A	D330 D332 D418	D194 D196 D255

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0016779 nucleotidyltransferase activity
• GO:0034061 DNA polymerase activity

Biological Process

• GO:0006281 DNA repair

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:4ycx, PDBe:4ycx, PDBj:4ycx
• PDBsum: 4ycx
• PubMed: 26240373
• UniProt: Q9NP87|DPOLM_HUMAN DNA-directed DNA/RNA polymerase mu (Gene Name=POLM)