Structure of PDB 4y5q Chain A

Receptor sequence

>4y5qA (length=449) Species: 353152 (Cryptosporidium parvum Iowa II)

LYFQGTFAERYNIVCMLGKGSFGEVLKCKDRITQQEYAVKVINKASAKNK
DTSTILREVELLKKLDHPNIMKLFEILEDSSSFYIVGELYTGGELFDEII
KRKRFSEHDAARIIKQVFSGITYMHKHNIVHRDLKPENILLESKEKDCDI
KIIDFGLSTCFQQNTDRIGTAYYIAPEVLRGTYDEKCDVWSAGVILYILL
SGTPPFYGKNEYDILKRVETGKYAFDLPQWRTISDDAKDLIRKMLTFHPS
LRITATQCLEHPWIQKYSSETPTISDLPSLESAMTNIRQFQAEKKLAQAA
LLYMASKLTTLDETKQLTEIFRKLDTNNDGMLDRDELVRGYHEFMRLKGV
DSNSGSTIEDQIDSLMPLLDMDGSGSIEYSEFIASAIDRTILLSRERMER
AFKMFDKDGSGKISTKELFKLFSEQVDNNKDGEVDFNEFVEMLQNFVRN

3D structure

• PDB: 4y5q Multiple determinants for selective inhibition of apicomplexan calcium-dependent protein kinase CDPK1.
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D198 K200 E202 N203 D219 T238
• Catalytic site (residue number reindexed from 1): D133 K135 E137 N138 D154 T170

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	D393 N395 D397 M399 E404	D325 N327 D329 M331 E336
BS02	CA	A	D443 D445 S447 S449 E451 E454	D370 D372 S374 S376 E378 E381
BS03	CA	A	D479 D481 S483 K485 E490	D406 D408 S410 K412 E417
BS04	CA	A	D515 N517 D519 E521 E526	D427 N429 D431 E433 E438
BS05	AMP	A	G83 G85 V90 A103 K105 Y155 L205 D219	G18 G20 V25 A38 K40 Y90 L140 D154

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0005509 calcium ion binding
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation

External links

• PDB: RCSB:4y5q, PDBe:4y5q, PDBj:4y5q
• PDBsum: 4y5q
• UniProt: A3FQ16