Structure of PDB 4xwz Chain A

Receptor sequence

>4xwzA (length=438) Species: 746128 (Aspergillus fumigatus)

ILSTESSIIVIGAGTWGCSTALHLARRGYKDVTVLDPHPVPSPIAAGNDI
NKIMEHSELKDGSSDPRSAAFSTFTRAALKAWKTDPVFQPYFHETGFIIS
GHTPALIDHIRKDEVEPSETNFVKLETAEDFRRTMPPGVLTGDFPGWKGW
LHKSGAGWIHAKKAMISAFNEAKRLGVRFVTGSPEGNVVSLVYEDGDVVG
ARTADGRVHKAHRTILSAGAGSDSLLDFKKQLRPTAWTLCHIQMGPEEVK
QYRNLPVLFNIAKGFFMEPDEDKHELKICDEHPGYCNFLPDPNRPGQEKS
VPFAKHQIPLEAEARARDFLHDTMPHLADRPLSFARICWDADTPDRAFLI
DRHPEHPSLLVAVGGSGNGAMQMPTIGGFIADALESKLQKEVKDIVRWRP
ETAVDRDWRATQNRFGGPDRIMDFQQVGEDQWTKIGES

3D structure

• PDB: 4xwz Crystal structure of the deglycating enzyme Amadoriase I in its free form and substrate-bound complex.
• Chain: A
• Resolution: 1.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): N52 N55 K56
• Catalytic site (residue number reindexed from 1): N48 N51 K52

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	I15 G16 G18 T19 W20 D40 P41 S46 I48 A49 A50 G51 K56 I57 V192 A222 G223 C342 D344 G369 G371 N372 G373 A374 M375	I11 G12 G14 T15 W16 D36 P37 S42 I44 A45 A46 G47 K52 I53 V188 A218 G219 C338 D340 G365 G367 N368 G369 A370 M371
BS02	LYS	A	E59 G371 N372 M375	E55 G367 N368 M371
BS03	BDF	A	W241 F269 E285 G371 R418	W237 F265 E281 G367 R414

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0008115 sarcosine oxidase activity
• GO:0016491 oxidoreductase activity
• GO:0050660 flavin adenine dinucleotide binding
• GO:0051698 saccharopine oxidase activity

External links

• PDB: RCSB:4xwz, PDBe:4xwz, PDBj:4xwz
• PDBsum: 4xwz
• PubMed: 26873906
• UniProt: O42629