Structure of PDB 4xwh Chain A

Receptor sequence
>4xwhA (length=720) Species: 9606 (Homo sapiens) [Search protein sequence]
DEAREAAAVRALVARLLGPGPAADFSVSVERALAAKPGLDTYSLGGGGAA
RVRVRGSTGVAAAAGLHRYLRDFCGCHVAWSGSQLRLPRPLPAVPGELTE
ATPNRYRYYQNVCTQSYSFVWWDWARWEREIDWMALNGINLALAWSGQEA
IWQRVYLALGLTQAEINEFFTGPAFLAWGRMGNLHTWDGPLPPSWHIKQL
YLQHRVLDQMRSFGMTPVLPAFAGHVPEAVTRVFPQVNVTKMGSWGHFNC
SYSCSFLLAPEDPIFPIIGSLFLRELIKEFGTDHIYGADTFNEMQPPSSE
PSYLAAATTAVYEAMTAVDTEAVWLLQGWLFQHQPQFWGPAQIRAVLGAV
PRGRLLVLDLFAESQPVYTRTASFQGQPFIWCMLHNFGGNHGLFGALEAV
NGGPEAARLFPNSTMVGTGMAPEGISQNEVVYSLMAELGWRKDPVPDLAA
WVTSFAARRYGVSHPDAGAAWRLLLRSVYNCSGEACRGHNRSPLVRRPSL
QMNTSIWYNRSDVFEAWRLLLTSAPSLATSPAFRYDLLDLTRQAVQELVS
LYYEEARSAYLSKELASLLRAGGVLAYELLPALDEVLASDSRFLLGSWLE
QARAAAVSEAEADFYEQNSRYQLTLWGPEGNILDYANKQLAGLVANYYTP
RWRLFLEALVDSVAQGIPFQQHQFDKNVFQLEQAFVLSKQRYPSQPRGDT
VDLAKKIFLKYYPRWVAGSW
3D structure
PDB4xwh Structural characterization of the alpha-N-acetylglucosaminidase, a key enzyme in the pathogenesis of Sanfilippo syndrome B.
ChainA
Resolution2.32 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.2.1.50: alpha-N-acetylglucosaminidase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 XYL A A87 H90 R94 N160 A459 E460 W463 A64 H67 R71 N137 A436 E437 W440
BS02 XYL A Y140 W201 E316 E446 Y658 Y117 W178 E293 E423 Y635
Gene Ontology
Molecular Function
GO:0004561 alpha-N-acetylglucosaminidase activity
GO:0016798 hydrolase activity, acting on glycosyl bonds
Biological Process
GO:0001573 ganglioside metabolic process
GO:0001774 microglial cell activation
GO:0001889 liver development
GO:0001944 vasculature development
GO:0003158 endothelium development
GO:0003170 heart valve development
GO:0003183 mitral valve morphogenesis
GO:0003220 left ventricular cardiac muscle tissue morphogenesis
GO:0006029 proteoglycan metabolic process
GO:0006801 superoxide metabolic process
GO:0006914 autophagy
GO:0006954 inflammatory response
GO:0007028 cytoplasm organization
GO:0007030 Golgi organization
GO:0007033 vacuole organization
GO:0007040 lysosome organization
GO:0007399 nervous system development
GO:0007507 heart development
GO:0007626 locomotory behavior
GO:0008340 determination of adult lifespan
GO:0009100 glycoprotein metabolic process
GO:0009611 response to wounding
GO:0010467 gene expression
GO:0014004 microglia differentiation
GO:0016485 protein processing
GO:0021675 nerve development
GO:0021680 cerebellar Purkinje cell layer development
GO:0022008 neurogenesis
GO:0030200 heparan sulfate proteoglycan catabolic process
GO:0030201 heparan sulfate proteoglycan metabolic process
GO:0030202 heparin metabolic process
GO:0030203 glycosaminoglycan metabolic process
GO:0030534 adult behavior
GO:0031069 hair follicle morphogenesis
GO:0032496 response to lipopolysaccharide
GO:0032963 collagen metabolic process
GO:0034142 toll-like receptor 4 signaling pathway
GO:0034285 response to disaccharide
GO:0034599 cellular response to oxidative stress
GO:0035633 maintenance of blood-brain barrier
GO:0035640 exploration behavior
GO:0035904 aorta development
GO:0035909 aorta morphogenesis
GO:0042445 hormone metabolic process
GO:0042474 middle ear morphogenesis
GO:0042982 amyloid precursor protein metabolic process
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0044242 cellular lipid catabolic process
GO:0045475 locomotor rhythm
GO:0046548 retinal rod cell development
GO:0048143 astrocyte activation
GO:0048708 astrocyte differentiation
GO:0055013 cardiac muscle cell development
GO:0060041 retina development in camera-type eye
GO:0060119 inner ear receptor cell development
GO:0060173 limb development
GO:0060586 multicellular organismal-level iron ion homeostasis
GO:0061744 motor behavior
GO:0071407 cellular response to organic cyclic compound
GO:0097577 sequestering of iron ion
GO:0097696 cell surface receptor signaling pathway via STAT
GO:0099022 vesicle tethering
GO:0150076 neuroinflammatory response
GO:1901135 carbohydrate derivative metabolic process
GO:1904389 rod bipolar cell differentiation
GO:1904390 cone retinal bipolar cell differentiation
Cellular Component
GO:0005764 lysosome
GO:0005773 vacuole
GO:0043202 lysosomal lumen
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4xwh, PDBe:4xwh, PDBj:4xwh
PDBsum4xwh
PubMed30802506
UniProtP54802|ANAG_HUMAN Alpha-N-acetylglucosaminidase (Gene Name=NAGLU)

[Back to BioLiP]