Structure of PDB 4xv4 Chain A

Receptor sequence

>4xv4A (length=289) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

LVHVASVEKGRSYEDFQKVYNAIALKLREDDEYDNYIGYGPVLVRLAWHI
SGTWDKHDNTGGSYGGTYRFKKEFNDPSNAGLQNGFKFLEPIHKEFPWIS
SGDLFSLGGVTAVQEMQGPKIPWRCGRVDTPEDTTPDNGRLPDADKDAGY
VRTFFQRLNMNDREVVALMGAHALGKTHLKNSGYEGGGANNVFTNEFYLN
LLNEDWKLEKNDANNEQWDSKSGYMMLPTDYSLIQDPKYLSIVKEYANDQ
DKFFKDFSKAFEKLLENGITFPKDAPSPFIFKTLEEQGL

3D structure

PDB

4xv4 One Crystal, Two Temperatures: Cryocooling Penalties Alter Ligand Binding to Transient Protein Sites.

Chain

Resolution

1.69 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	R48 H52 H175 D233
Catalytic site (residue number reindexed from 1)	R45 H49 H172 D230
Enzyme Commision number	1.11.1.5: cytochrome-c peroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	P44 R48 W51 P145 D146 L171 M172 A174 H175 G178 K179 T180 H181 N184 S185 L230	P41 R45 W48 P142 D143 L168 M169 A171 H172 G175 K176 T177 H178 N181 S182 L227
BS02	25T	A	H175 L177 G178 K179 T180 G190 L230	H172 L174 G175 K176 T177 G187 L227	MOAD: Kd=68mM
BS03	25T	A	F89 L92 E93 H96 S104 F108	F86 L89 E90 H93 S101 F105	MOAD: Kd=68mM

Gene Ontology

	Molecular Function
GO:0004601	peroxidase activity
GO:0020037	heme binding

	Biological Process
GO:0006979	response to oxidative stress
GO:0034599	cellular response to oxidative stress

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4xv4, PDBe:4xv4, PDBj:4xv4
PDBsum	4xv4
PubMed	26032594
UniProt	P00431\|CCPR_YEAST Cytochrome c peroxidase, mitochondrial (Gene Name=CCP1)

[Back to BioLiP]