Structure of PDB 4xt8 Chain A

Receptor sequence

>4xt8A (length=246) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]

PLRLLSSVHYLTDGELPQLYDYPDDGTWLRANFISSLDGGATVDGTSGAM
AGPGDRFVFNLLRELADVIVVGVGTVRIEGYSGVRMGVVQRQHRQARGQS
EVPQLAIVTRSGRLDRDMAVFTRTEMAPLVLTTTAVADDTRQRLAGLAEV
IACSGDDPGTVDEAVLVSQLAARGLRRILTEGGPTLLGTFVERDVLDELC
LTIAPYVVGGLARRIVTGPGQVLTRMRCAHVLTDDSGYLYTRYVKT

3D structure

PDB

4xt8 Structural Insights into Mycobacterium tuberculosis Rv2671 Protein as a Dihydrofolate Reductase Functional Analogue Contributing to para-Aminosalicylic Acid Resistance.

Chain

Resolution

1.95 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	A	F45 I46 A53 T54 G57 S59 G84 V85 G86 T87 I90 E91 V120 T121 R122 S123 V173 E175 E193 G194 G195 P196 T197 L198 T201	F33 I34 A41 T42 G45 S47 G72 V73 G74 T75 I78 E79 V108 T109 R110 S111 V161 E163 E181 G182 G183 P184 T185 L186 T189
BS02	TMQ	A	N44 F45 I46 S59 D67 F71 R75 E91	N32 F33 I34 S47 D55 F59 R63 E79	MOAD: ic50=0.28uM

Gene Ontology

	Molecular Function
GO:0000166	nucleotide binding
GO:0008703	5-amino-6-(5-phosphoribosylamino)uracil reductase activity
GO:0016491	oxidoreductase activity

	Biological Process
GO:0009231	riboflavin biosynthetic process

	Cellular Component
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4xt8, PDBe:4xt8, PDBj:4xt8
PDBsum	4xt8
PubMed	26848874
UniProt	P71968

[Back to BioLiP]