Structure of PDB 4xr1 Chain A

Receptor sequence

>4xr1A (length=307) Species: 83333 (Escherichia coli K-12)

RYDLVDRLNTTFRQMEQELAIFAAHLEQHKLLVARVFSLPEVKKEDEHNP
LNRIEVKQHLGNDAQSLALRHFRHLFIQQQSENRSSKAAVRLPGVLCYQV
DNLSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLIT
LNAYRTLTVLHDPATLRFGWANKHIIKNLHRDEVLAQLEKSLKSPRSVAP
WTREEWQRKLEREYQDIAALPQNAKLKIKRPVKVQPIARVWYKGDQKQVQ
HACPTPLIALINRDNGAGVPDVGELLNYDADNVQHRYKPQAQPLRLIIPR
LHLYVAD

3D structure

• PDB: 4xr1 Replisome speed determines the efficiency of the Tus-Ter replication termination barrier.
• Chain: A
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	S88 K89 T129 R139 F140 L153 Y156 R169 A173 N174 K175 H176 I178 K179 N180 R241 W243 Q250 V285 H287 R288 P291 A293 Q294	S86 K87 T127 R137 F138 L151 Y154 R167 A171 N172 K173 H174 I176 K177 N178 R239 W241 Q248 V283 H285 R286 P289 A291 Q292
BS02	dna	A	H50 K89 A90 A91 R93 R157 T158 K175 S193 P197 R198 R232 V234 Q237 Q252 R288 Y289 R302	H48 K87 A88 A89 R91 R155 T156 K173 S191 P195 R196 R230 V232 Q235 Q250 R286 Y287 R300

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0043565 sequence-specific DNA binding

Biological Process

• GO:0006260 DNA replication
• GO:0006274 DNA replication termination
• GO:0071807 replication fork arrest involved in DNA replication termination

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4xr1, PDBe:4xr1, PDBj:4xr1
• PDBsum: 4xr1
• PubMed: 26322585
• UniProt: P16525|TUS_ECOLI DNA replication terminus site-binding protein (Gene Name=tus)