Structure of PDB 4xic Chain A

Receptor sequence
>4xicA (length=59) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
KRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQN
RRMKWKKEN
3D structure
PDB4xic Entropic Enhancement of Protein-DNA Affinity by Oxygen-to-Sulfur Substitution in DNA Phosphate.
ChainA
Resolution2.69 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A K2 R5 Y25 R31 Q50 R53 M54 K57 K1 R4 Y24 R30 Q49 R52 M53 K56 PDBbind-CN: Kd=2.9nM
BS02 dna A R3 R5 Q6 Y8 R43 I47 N51 R2 R4 Q5 Y7 R42 I46 N50 PDBbind-CN: Kd=2.9nM
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4xic, PDBe:4xic, PDBj:4xic
PDBsum4xic
PubMed26331260
UniProtP02833|ANTP_DROME Homeotic protein antennapedia (Gene Name=Antp)

[Back to BioLiP]