Structure of PDB 4xf6 Chain A

Receptor sequence

>4xf6A (length=273) Species: 69014 (Thermococcus kodakarensis KOD1)

MKCLVVGHVVRDIVKKGNKVLERLGGGAYYSALALSRFCDVEILTSFSNL
PEEWIKELESMAKLQVVPSETTTTYELTYLDGNRRRLKLLERASPIEELP
DGEYDVLLMNPVAREVPPALVTSALKKFPFVAVDIQGFIRSSSPGEIQYQ
PIDGSFLKGVKILHADLGEYQYLQGFSPEFVDVLLLSNGPEPGKAFLHGR
EYTFEPVHVGVDESTGAGDVFLGAFTGFYSQCPFVQALKRAAAFTALFLK
NRSVDFSMDDVNELAMKVEVKRV

3D structure

• PDB: 4xf6 Crystal Structure and Product Analysis of an Archaeal myo-Inositol Kinase Reveal Substrate Recognition Mode and 3-OH Phosphorylation
• Chain: A
• Resolution: 2.08 Å

Enzymatic activity

• Enzyme Commision number: 2.7.1.64: inositol 3-kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	LIP	A	D12 G25 G26 Y30 Y75 R85 V112 Q136 R140 T215 G216 D219	D12 G25 G26 Y30 Y75 R85 V112 Q136 R140 T215 G216 D219
BS02	ADP	A	N83 D166 S187 G189 P190 F204 P206 A217 G218 T245 L249	N83 D166 S187 G189 P190 F204 P206 A217 G218 T245 L249
BS03	INS	A	D12 G25 G26 Y30 Y75 V112 Q136 R140 D219	D12 G25 G26 Y30 Y75 V112 Q136 R140 D219

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0016301 kinase activity

Biological Process

• GO:0016310 phosphorylation

External links

• PDB: RCSB:4xf6, PDBe:4xf6, PDBj:4xf6
• PDBsum: 4xf6
• PubMed: 25972008
• UniProt: Q5JDA3