Structure of PDB 4xdy Chain A

Receptor sequence

>4xdyA (length=331) Species: 285389 (uncultured archaeon GZfos26G2)

MEILHDEDVDDSILRDKTIAVMGYGAQGDAQANCLKDSGINVVIGETEIL
GGNKNPSWEKAKEDGFEVLPIDKAAEKGDVVHILLPDEVQPAIYENQIKP
QLKAGKALCFSHGFNICFKRIVPPEDVDVIMVAPKAPGTEERKAYLEGFG
VPGLVAVKQNPSGEAREVALAMTKAMHWTKAGILECTFEQETYEDLFGEQ
CVLCGGLVELMRNGFEVLVEAGYPPEMAYFECVHEMKLIVDLVWQGGIKR
MAEVISNTAEYGMWAVGHQIIGPEVKEKMKEALKRVENGEFANEWVDEYK
RGIPFLKASREKMGEHQVETVGAEIRKLFAQ

3D structure

• PDB: 4xdy Cofactor specificity motifs and the induced fit mechanism in class I ketol-acid reductoisomerases.
• Chain: A
• Resolution: 1.535 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K135 D195 E199
• Catalytic site (residue number reindexed from 1): K135 D195 E199
• Enzyme Commision number: 1.1.1.382: ketol-acid reductoisomerase (NAD(+)).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	D195 E199	D195 E199
BS02	NAI	A	G25 A26 Q27 E46 L50 N55 S57 L84 L85 P86 D87 I93 H112 P137	G25 A26 Q27 E46 L50 N55 S57 L84 L85 P86 D87 I93 H112 P137
BS03	HIO	A	P137 D195 E199	P137 D195 E199
BS04	HIO	A	E235 I239 I255 S256 A259	E235 I239 I255 S256 A259

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0004455 ketol-acid reductoisomerase activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0050661 NADP binding

Biological Process

• GO:0008652 amino acid biosynthetic process
• GO:0009082 branched-chain amino acid biosynthetic process
• GO:0009097 isoleucine biosynthetic process
• GO:0009099 L-valine biosynthetic process

External links

• PDB: RCSB:4xdy, PDBe:4xdy, PDBj:4xdy
• PDBsum: 4xdy
• PubMed: 25849365
• UniProt: Q64BR7|ILVC_UNCAG Ketol-acid reductoisomerase (NAD(+)) (Gene Name=ilvC)