Structure of PDB 4x88 Chain A |
>4x88A (length=92) Species: 156889 (Magnetococcus marinus MC-1) [Search protein sequence] |
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLDSW SMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM |
|
PDB | 4x88 Molecular basis of ion permeability in a voltage-gated sodium channel. |
Chain | A |
Resolution | 3.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
2CV |
A |
N194 W196 |
N64 W66 |
|
|
|
|