Structure of PDB 4x7g Chain A

Receptor sequence

>4x7gA (length=251) Species: 272942 (Rhodobacter capsulatus SB 1003)

MTRLLVLGGTTEASRLAKTLADQGFEAVFSYAGRTGAPVAQPLPTRIGGF
GGVAGLVDYLTREGVSHVIDATHPFAAQMSANAVAACAQTGVALCAFERA
PWTAQAGDRWTHVPDLAAAVAALPQAPARVFLAIGKQHLRDFSAAPQHHY
LLRLVDPPEGPLPLPDARAVIARGPFTVQGDTELLRSETITHVVAKNAGG
AGAEAKLIAARSLGLPVILIDRPAVPARDICATLEGVMGWLADHGATPRG
V

3D structure

• PDB: 4x7g Crystal structure of CobK reveals strand-swapping between Rossmann-fold domains and molecular basis of the reduced precorrin product trap.
• Chain: A
• Resolution: 1.22 Å

Enzymatic activity

• Enzyme Commision number: 1.3.1.54: precorrin-6A reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	A	G8 G9 S30 Y31 A32 R34 G48 G49 F50 G51 G52A T72 H73 A76 Q78 M79 N82 Q137 K196	G8 G9 S30 Y31 A32 R34 G48 G49 F50 G51 G52 T72 H73 A76 Q78 M79 N82 Q137 K196
BS02	3Y8	A	G9 T10 T11 S14 Y31 A32 G33 T35 P38 V39 H73 I134 G135 K136 Q137 R153 V155 R173 G174 P175 K196 K206	G9 T10 T11 S14 Y31 A32 G33 T35 P38 V39 H73 I134 G135 K136 Q137 R153 V155 R173 G174 P175 K196 K206

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity
• GO:0016994 precorrin-6A reductase activity

Biological Process

• GO:0009236 cobalamin biosynthetic process

External links

• PDB: RCSB:4x7g, PDBe:4x7g, PDBj:4x7g
• PDBsum: 4x7g
• PubMed: 26616290
• UniProt: O68098|COBK_RHOCB Precorrin-6A reductase (Gene Name=cobK)