Structure of PDB 4x4u Chain A

Receptor sequence

>4x4uA (length=435) Species: 224325 (Archaeoglobus fulgidus DSM 4304)

MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYAR
NTWLKGSLEIDVFLLFPEEFSKEELRERGLEIGKAVLDSYEIRYHPYVHG
VVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLK
GFLKANGIYGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVID
VAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVHLCREFMEAPSLG
FFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASR
KIFEFLERENFMPLRSAFKASEEFCYLLFECQIKEISRVFRRMGPQFEDE
RNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTLGK
NVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD

3D structure

• PDB: 4x4u On-Enzyme Refolding Permits Small RNA and tRNA Surveillance by the CCA-Adding Enzyme.
• Chain: A
• Resolution: 2.7 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.72: CCA tRNA nucleotidyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	H97 Y99 V112 A126 T130 A163 Y165 A228 N229 D291 N292 P295 Q296 R299 R302 K303 M345 G346 P347 N354 K357 F358 H398 T399 G401 K402	H95 Y97 V110 A124 T128 A161 Y163 A226 N227 D289 N290 P293 Q294 R297 R300 K301 M343 G344 P345 N352 K355 F356 H396 T397 G399 K400
BS02	APC	A	G46 S47 R50 T130 H133 K152 Y161 Y173	G46 S47 R50 T128 H131 K150 Y159 Y171

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0000287 magnesium ion binding
• GO:0003723 RNA binding
• GO:0004810 CCA tRNA nucleotidyltransferase activity
• GO:0005524 ATP binding
• GO:0016779 nucleotidyltransferase activity
• GO:0046872 metal ion binding
• GO:0160016 CCACCA tRNA nucleotidyltransferase activity

Biological Process

• GO:0001680 tRNA 3'-terminal CCA addition
• GO:0008033 tRNA processing
• GO:0031123 RNA 3'-end processing
• GO:0042245 RNA repair
• GO:0106354 tRNA surveillance

External links

• PDB: RCSB:4x4u, PDBe:4x4u, PDBj:4x4u
• PDBsum: 4x4u
• PubMed: 25640237
• UniProt: O28126|CCA_ARCFU CCA-adding enzyme (Gene Name=cca)