Structure of PDB 4x4q Chain A

Receptor sequence

>4x4qA (length=443) Species: 224325 (Archaeoglobus fulgidus DSM 4304)

MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYAR
NTWLKGSLEIDVFLLFPEEFSKEELRERGLEIGKAVLDSYEIRYAEHPYV
HGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRL
LKGFLKANGIYGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTV
IDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVHLCREFMEAPS
LGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERA
SRKIFEFLERENFMPLRSAFKASEEFCYLLFECQIKEISRVFRRMGPQFE
DERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKDSNSSSV

3D structure

• PDB: 4x4q On-Enzyme Refolding Permits Small RNA and tRNA Surveillance by the CCA-Adding Enzyme.
• Chain: A
• Resolution: 3.15 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.72: CCA tRNA nucleotidyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	V127 T130 Y165 R224 A228 N229 N292 P295 Q296 R299 R344 M345 G346 P347 N354 F358 R361 H396 H398 K402	V127 T130 Y165 R224 A228 N229 N292 P295 Q296 R299 R344 M345 G346 P347 N354 F358 R361 H396 H398 K402
BS02	MG	A	E59 D61	E59 D61
BS03	MG	A	D61 D110	D61 D110
BS04	CTP	A	S47 R50 T130 H133 Y161 R224	S47 R50 T130 H133 Y161 R224

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0000287 magnesium ion binding
• GO:0003723 RNA binding
• GO:0004810 CCA tRNA nucleotidyltransferase activity
• GO:0005524 ATP binding
• GO:0016779 nucleotidyltransferase activity
• GO:0046872 metal ion binding
• GO:0160016 CCACCA tRNA nucleotidyltransferase activity

Biological Process

• GO:0001680 tRNA 3'-terminal CCA addition
• GO:0008033 tRNA processing
• GO:0031123 RNA 3'-end processing
• GO:0042245 RNA repair
• GO:0106354 tRNA surveillance

External links

• PDB: RCSB:4x4q, PDBe:4x4q, PDBj:4x4q
• PDBsum: 4x4q
• PubMed: 25640237
• UniProt: O28126|CCA_ARCFU CCA-adding enzyme (Gene Name=cca)