Structure of PDB 4x33 Chain A |
>4x33A (length=60) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] |
STYDEIEIEDMTFEPENQMFTYPCPCGDRFQIYLDDMFEGEKVAVCPSCS LMIDVVHHHH |
|
PDB | 4x33 Structure of the Elongator cofactor complex Kti11/Kti13 provides insight into the role of Kti13 in Elongator-dependent tRNA modification. |
Chain | A |
Resolution | 1.45 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE |
A |
C25 C27 C47 C50 |
C24 C26 C46 C49 |
|
|
|