Structure of PDB 4x2a Chain A

Receptor sequence
>4x2aA (length=167) Species: 10090 (Mus musculus) [Search protein sequence]
TAFSCCSDPDPSTKDFLLQQTMLRIKDPKKSLDFYTRVLGLTLLQKLDFP
AMKFSLYFLAYEDKNDIPKDKSEKTAWTFSRKATLELTHNWGTEDDETQS
YHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFI
QDPDGYWIEILNPNKIA
3D structure
PDB4x2a In Vitro Inhibition of Glyoxalase І by Flavonoids: New Insights from Crystallographic Analysis.
ChainA
Resolution2.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) Q34 E100 H127 E173
Catalytic site (residue number reindexed from 1) Q20 E86 H113 E159
Enzyme Commision number 4.4.1.5: lactoylglutathione lyase.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 ZN A H127 E173 H113 E159
BS02 ZN A Q34 E100 Q20 E86
BS03 3WL A H127 M158 E173 I180 A181 H113 M144 E159 I166 A167 MOAD: Ki=0.183uM
BS04 3WL A Q34 F63 L70 F93 E100 Q20 F49 L56 F79 E86 MOAD: Ki=0.183uM
Gene Ontology
Molecular Function
GO:0004462 lactoylglutathione lyase activity
GO:0008270 zinc ion binding
GO:0016829 lyase activity
GO:0046872 metal ion binding
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006749 glutathione metabolic process
GO:0009438 methylglyoxal metabolic process
GO:0019243 methylglyoxal catabolic process to D-lactate via S-lactoyl-glutathione
GO:0030316 osteoclast differentiation
GO:0043066 negative regulation of apoptotic process
Cellular Component
GO:0005654 nucleoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4x2a, PDBe:4x2a, PDBj:4x2a
PDBsum4x2a
PubMed26268338
UniProtQ9CPU0|LGUL_MOUSE Lactoylglutathione lyase (Gene Name=Glo1)

[Back to BioLiP]