Structure of PDB 4x23 Chain A

Receptor sequence
>4x23A (length=95) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV
MALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGIE
3D structure
PDB4x23 A conserved mechanism for centromeric nucleosome recognition by centromere protein CENP-C.
ChainA
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R42 T45 R83 F84 Q85 S86 R116 V117 T118 R3 T6 R44 F45 Q46 S47 R77 V78 T79 PDBbind-CN: Kd=0.1uM
BS02 dna A Y41 G44 V46 A47 R49 R63 K64 L65 P66 R69 R83 Y2 G5 V7 A8 R10 R24 K25 L26 P27 R30 R44 PDBbind-CN: Kd=0.1uM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4x23, PDBe:4x23, PDBj:4x23
PDBsum4x23
PubMed23723239
UniProtP02299|H3_DROME Histone H3 (Gene Name=His3)

[Back to BioLiP]