Structure of PDB 4x09 Chain A

Receptor sequence

>4x09A (length=128) Species: 9606 (Homo sapiens)

MWPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQ
NVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQY
KFFIVACDPPQKSDPPYKLVPVHLDSIL

3D structure

• PDB: 4x09 The first crystal structure of human RNase 6 reveals a novel substrate-binding and cleavage site arrangement.
• Chain: A
• Resolution: 1.722 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H15 K38 H122 L123 D124
• Catalytic site (residue number reindexed from 1): H16 K39 H123 L124 D125
• Enzyme Commision number: 3.1.27.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SO4	A	H15 H122	H16 H123
BS02	SO4	A	H36 H39	H37 H40

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0004519 endonuclease activity
• GO:0004540 RNA nuclease activity

Biological Process

• GO:0006401 RNA catabolic process
• GO:0006952 defense response
• GO:0019731 antibacterial humoral response
• GO:0042742 defense response to bacterium
• GO:0045087 innate immune response
• GO:0050829 defense response to Gram-negative bacterium
• GO:0050830 defense response to Gram-positive bacterium
• GO:0051607 defense response to virus
• GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005764 lysosome
• GO:0031410 cytoplasmic vesicle

External links

• PDB: RCSB:4x09, PDBe:4x09, PDBj:4x09
• PDBsum: 4x09
• PubMed: 27013146
• UniProt: Q93091|RNAS6_HUMAN Ribonuclease K6 (Gene Name=RNASE6)