Structure of PDB 4wzv Chain A

Receptor sequence
>4wzvA (length=158) Species: 9606 (Homo sapiens) [Search protein sequence]
GDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYS
RDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWS
LGKGVGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDV
NGIRHLYG
3D structure
PDB4wzv N-O-Isopropyl Sulfonamido-Based Hydroxamates as Matrix Metalloproteinase Inhibitors: Hit Selection and in Vivo Antiangiogenic Activity.
ChainA
Resolution1.65 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H226 E227 H230 H236
Catalytic site (residue number reindexed from 1) H115 E116 H119 H125
Enzyme Commision number 3.4.24.35: gelatinase B.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 E40 A L187 L188 A189 H190 A191 H226 E227 H230 D235 H236 L243 Y245 P246 M247 Y248 L76 L77 A78 H79 A80 H115 E116 H119 D124 H125 L132 Y134 P135 M136 Y137 MOAD: ic50=0.43nM
PDBbind-CN: -logKd/Ki=9.37,IC50=0.43nM
BindingDB: IC50=0.430000nM
BS02 ZN A H226 H230 H236 H115 H119 H125
BS03 ZN A H175 D177 H190 H203 H64 D66 H79 H92
BS04 CA A D165 G197 Q199 D201 D54 G86 Q88 D90
BS05 CA A D131 D206 E208 D20 D95 E97
BS06 CA A D182 G183 D185 L187 D205 E208 D71 G72 D74 L76 D94 E97
BS07 E40 A Y245 P246 Y134 P135 MOAD: ic50=0.43nM
PDBbind-CN: -logKd/Ki=9.37,IC50=0.43nM
BindingDB: IC50=0.430000nM
Gene Ontology
Molecular Function
GO:0004222 metalloendopeptidase activity
GO:0008237 metallopeptidase activity
GO:0008270 zinc ion binding
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0031012 extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wzv, PDBe:4wzv, PDBj:4wzv
PDBsum4wzv
PubMed26263024
UniProtP14780|MMP9_HUMAN Matrix metalloproteinase-9 (Gene Name=MMP9)

[Back to BioLiP]