Structure of PDB 4wzs Chain A |
>4wzsA (length=66) Species: 284813 (Encephalitozoon cuniculi GB-M1) [Search protein sequence] |
PISRLKRIMQLNEDIGKIGASVPVVASKAIEMFLTEIVGLTLKEASEFII RATESDPKFAFLKNME |
|
PDB | 4wzs Structural basis for recognition and remodeling of the TBP:DNA:NC2 complex by Mot1. |
Chain | A |
Resolution | 3.78 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
A |
G33 A34 |
G19 A20 |
|
BS02 |
dna |
A |
I16 S17 |
I2 S3 |
|
|
|
|