Structure of PDB 4wuh Chain A

Receptor sequence

>4wuhA (length=68) Species: 699185 (Enterococcus faecalis S613)

MVLHEDLTNREHEILMLIAQGKSNQEIADELFITLKTVKTHVSNILAKLD
VDNRTQAAIYAFQHGLAK

3D structure

• PDB: 4wuh A variable DNA recognition site organization establishes the LiaR-mediated cell envelope stress response of enterococci to daptomycin.
• Chain: A
• Resolution: 2.294 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	S162 N163 K178 S182 N192 R193	S23 N24 K39 S43 N53 R54

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Nov 26 06:09:55 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4wuh', asym_id = 'A', title = 'A variable DNA recognition site organization est...pe stress response of enterococci to daptomycin. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4wuh', asym_id='A', title='A variable DNA recognition site organization est...pe stress response of enterococci to daptomycin. ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003677,0006355', uniprot = '', pdbid = '4wuh', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0006355', uniprot='', pdbid='4wuh', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>