Structure of PDB 4wqb Chain A

Receptor sequence

>4wqbA (length=230) Species: 572477 (Allochromatium vinosum DSM 180)

TVALTVPAAALLPDGALGESIVRGRRYLSDTPAQLPDFVGNGLACRHCHP
GRDGEVGTEANAAPFVGVVGRFPQYSARHGRLITLEQRIGDCFERSLNGR
ALALDHPALIDMLAYMSWLSQGVPVGAVVAGHGIPTLTLEREPDGVHGEA
LYQARCLACHGADGSGTLDADGRYLFPPLWGPRSFNTGAGMNRQATAAGF
IKHKMPLGSLSDEEAWDVAGFVLTHPRPLF

3D structure

• PDB: 4wqb Thiosulfate Dehydrogenase (TsdA) from Allochromatium vinosum: STRUCTURAL AND FUNCTIONAL INSIGHTS INTO THIOSULFATE OXIDATION.
• Chain: A
• Resolution: 1.5013 Å

Enzymatic activity

• Enzyme Commision number: 1.8.2.2: thiosulfate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	C49 C52 H53 F69 C96 F97 S100 L101 G137 I138 F189 M195	C45 C48 H49 F65 C92 F93 S96 L97 G133 I134 F185 M191
BS02	HEC	A	H51 C52 R159 C160 C163 H164 F180 P181 P182 L183 F189 F204 I205 M209 P210 L211	H47 C48 R155 C156 C159 H160 F176 P177 P178 L179 F185 F200 I201 M205 P206 L207
BS03	SO3	A	R82 C96 R99 S100 A193	R78 C92 R95 S96 A189

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:0050338 thiosulfate dehydrogenase activity

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:4wqb, PDBe:4wqb, PDBj:4wqb
• PDBsum: 4wqb
• PubMed: 25673691
• UniProt: D3RVD4|TSDA_ALLVD Thiosulfate dehydrogenase (Gene Name=tsdA)