Structure of PDB 4wor Chain A

Receptor sequence

>4worA (length=136) Species: 1280 (Staphylococcus aureus)

KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYG
PEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVR
QGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS

3D structure

• PDB: 4wor Three-dimensional diffuse x-ray scattering from crystals of Staphylococcal nuclease.
• Chain: A
• Resolution: 1.596 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D21 R35 D40 T41 E43 R87
• Catalytic site (residue number reindexed from 1): D16 R30 D35 T36 E38 R82
• Enzyme Commision number: 3.1.31.1: micrococcal nuclease.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	D21 D40 T41	D16 D35 T36
BS02	THP	A	R35 K84 Y85 R87 L89 Y113 Y115	R30 K79 Y80 R82 L84 Y108 Y110

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0004518 nuclease activity

External links

• PDB: RCSB:4wor, PDBe:4wor, PDBj:4wor
• PDBsum: 4wor
• PubMed: 9177191
• UniProt: P00644|NUC_STAAU Thermonuclease (Gene Name=nuc)