Structure of PDB 4wok Chain A

Receptor sequence

>4wokA (length=325) Species: 444178 (Brucella ovis ATCC 25840)

ANNVLVVGGAGFIGSHTAKLLAGQGYAPVVYDNLSTGHQSAVRWGDFVEG
DILDQARLVETMEKYAPVAVIHFAASAYVGESVEDPAKYYRNNVGGTQSL
LDACRLTRTQNVIFSSSCATYGVPSRLPIGEGEAQNPINPYGRTKLIAEH
MLADYAVAYGLRYVALRYFNASGADIDGELGEKHDPETHLIPRAMMAAAG
RLDVLEVYGDDYETPDGTCIRDYIHVTDLARAHVLAVEHLKEAGGNLAVN
LGTGRGTSIREIVQSIGRLTGRSVPVAMRARRAGDPPALYADPALAAEKL
GFHTVYSDLDTIIRTAAPHFGLEVR

3D structure

• PDB: 4wok Crystal structure of UDP-glucose 4-epimerase from Brucella ovis in complex with NAD
• Chain: A
• Resolution: 1.85 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S119 C120 A121 Y143 K147 H186 H191
• Catalytic site (residue number reindexed from 1): S117 C118 A119 Y141 K145 H184 H189
• Enzyme Commision number: 5.1.3.2: UDP-glucose 4-epimerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	A	G10 G13 F14 I15 D34 N35 L36 S37 T38 G39 D53 I54 F75 A76 A77 S78 N94 S118 Y143 K147 Y170 A173 H186	G8 G11 F12 I13 D32 N33 L34 S35 T36 G37 D51 I52 F73 A74 A75 S76 N92 S116 Y141 K145 Y168 A171 H184
BS02	ZN	A	E184 H186 E189 H191	E182 H184 E187 H189

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0003978 UDP-glucose 4-epimerase activity
• GO:0016853 isomerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006012 galactose metabolic process
• GO:0033499 galactose catabolic process via UDP-galactose

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:4wok, PDBe:4wok, PDBj:4wok
• PDBsum: 4wok
• UniProt: A0A0H3ASR6