Structure of PDB 4wn3 Chain A

Receptor sequence

>4wn3A (length=220) Species: 559292 (Saccharomyces cerevisiae S288C)

IMLEDYQKNFLELAIECQALRFGSFKLKSGRESPYFFNLGLFNTGKLLSN
LATAYAIAIIQSDLKFDVIFGPAYKGIPLAAIVCVKLAEIGGSKFQNIQY
AFNRKEAKDGGIIVGSALENKRILIIDDVMTAGTAINEAFEIISNAKGQV
VGSIIALDRQEVVSTDDKEGLSATQTVSKKYGIPVLSIVSLIHIITYLEG
RITAEEKSKIEQYLQTYGAS

3D structure

• PDB: 4wn3 Crystal structure of Saccharomyces cerevisiae OMP synthase in complex with PRP(NH)P
• Chain: A
• Resolution: 1.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K109
• Catalytic site (residue number reindexed from 1): K108
• Enzyme Commision number: 2.4.2.10: orotate phosphoribosyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	3R3	A	Y75 K76 D131 D132 V133 M134 T135 A136 G137 T138 A139	Y74 K75 D127 D128 V129 M130 T131 A132 G133 T134 A135

Gene Ontology

Molecular Function

• GO:0004588 orotate phosphoribosyltransferase activity
• GO:0016757 glycosyltransferase activity

Biological Process

• GO:0006207 'de novo' pyrimidine nucleobase biosynthetic process
• GO:0006221 pyrimidine nucleotide biosynthetic process
• GO:0044205 'de novo' UMP biosynthetic process
• GO:0046132 pyrimidine ribonucleoside biosynthetic process
• GO:0055086 nucleobase-containing small molecule metabolic process
• GO:0072528 pyrimidine-containing compound biosynthetic process

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:4wn3, PDBe:4wn3, PDBj:4wn3
• PDBsum: 4wn3
• UniProt: P13298|PYRE_YEAST Orotate phosphoribosyltransferase 1 (Gene Name=URA5)