Structure of PDB 4wls Chain A

Receptor sequence
>4wlsA (length=111) Species: 668369 (Escherichia coli DH5[alpha]) [Search protein sequence]
MNISDVAKITGLTSKAIRFYEEKGLVTPPMRSENGYRTYTQQHLNELTLL
RQARQVGFNLEESGELVNLFNDPQRHSADVKRRTLEKVAEIERHIEELQS
MRDQLLALANA
3D structure
PDB4wls Allosteric transcriptional regulation via changes in the overall topology of the core promoter.
ChainA
Resolution2.105 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A I3 S4 R18 R31 Y36 R37 I3 S4 R18 R31 Y36 R37
BS02 dna A T13 K15 A16 F19 Y20 N34 Y36 R54 L60 T13 K15 A16 F19 Y20 N34 Y36 R54 L60
BS03 dna A I3 S4 R18 R31 Y36 R37 I3 S4 R18 R31 Y36 R37
BS04 dna A T13 K15 F19 Y20 N34 Y36 R54 L60 T13 K15 F19 Y20 N34 Y36 R54 L60
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0000987 cis-regulatory region sequence-specific DNA binding
GO:0001216 DNA-binding transcription activator activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005507 copper ion binding
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wls, PDBe:4wls, PDBj:4wls
PDBsum4wls
PubMed26293965
UniProtP0A9G4|CUER_ECOLI HTH-type transcriptional regulator CueR (Gene Name=cueR)

[Back to BioLiP]