Structure of PDB 4wig Chain A

Receptor sequence
>4wigA (length=126) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
DVDWNMLRGNATQAAAGAYVPYSRFAVGAAALVDDGRVVTGCNVDNVSYG
LTLCAECAVVCALHSTGGGRLLALACVDGHGSVLMPCGRCRQVLLEHGGS
ELLIDHPVRPRRLGDLLPDAFGLDDL
3D structure
PDB4wig Functional and structural evidence for the catalytic role played by glutamate-47 residue in the mode of action of Mycobacterium tuberculosis cytidine deaminase
ChainA
Resolution1.758 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) C56 E58 C89 C92
Catalytic site (residue number reindexed from 1) C54 E56 C87 C90
Enzyme Commision number 3.5.4.5: cytidine deaminase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A C56 C89 C92 C54 C87 C90
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0004126 cytidine deaminase activity
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity
GO:0046872 metal ion binding
Biological Process
GO:0009972 cytidine deamination
GO:0043100 pyrimidine nucleobase salvage
GO:0046109 uridine biosynthetic process
GO:0055086 nucleobase-containing small molecule metabolic process
GO:0072527 pyrimidine-containing compound metabolic process
GO:1901135 carbohydrate derivative metabolic process
Cellular Component
GO:0005829 cytosol
GO:0005886 plasma membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wig, PDBe:4wig, PDBj:4wig
PDBsum4wig
PubMed
UniProtP9WPH3|CDD_MYCTU Cytidine deaminase (Gene Name=cdd)

[Back to BioLiP]