Structure of PDB 4wfd Chain A |
>4wfdA (length=91) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] |
ENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFSKDLKSKADKLADMA NEIILSIDEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAIN |
|
PDB | 4wfd The exosome-binding factors Rrp6 and Rrp47 form a composite surface for recruiting the Mtr4 helicase. |
Chain | A |
Resolution | 2.4 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
R18 S21 S25 Q26 |
R15 S18 S22 Q23 |
|
|
|
|