Structure of PDB 4wce Chain A

Receptor sequence

>4wceA (length=269) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]

IKKYKPITNGRRNMTSLDFAEITKTTPEKSLLKPLPKKAGRNNQGKLTVR
HHGGGHKRQYRVIDFKRNKDGINAKVDSIQYDPNRSANIALVVYADGEKR
YIIAPKGLEVGQIVESGAEADIKVGNALPLQNIPVGTVVHNIELKPGKGG
QIARSAGASAQVLGKEGKYVLIRLRSGEVRMILSTCRATIGQVGNLQHEL
VNVGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGRAPIGRPSPMSPWGK
PTLGKKTRRGKKSSDKLIV

3D structure

PDB

4wce Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.

Chain

Resolution

3.526 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	P8 I9 T10 N11 G12 R14 K40 A41 R43 N44 N45 Q46 G47 K48 L49 T50 V51 H53 H54 G56 H58 K59 R60 Q61 P85 V95 D98 G99 G149 Q153 I154 A155 R156 S157 A158 G159 Y171 L176 S178 E180 L198 H200 E201 N204 V205 G206 A208 R210 S211 R212 W213 R217 P218 T219 V220 R221 G222 S223 V224 M225 N226 P227 N228 D229 H232 G234 G235 E236 G237 R238 P240 I241 G242 R243 P244 P246 S248 P249 W250 T254 G256 K258 T259 R260 S266	P6 I7 T8 N9 G10 R12 K38 A39 R41 N42 N43 Q44 G45 K46 L47 T48 V49 H51 H52 G54 H56 K57 R58 Q59 P83 V93 D96 G97 G147 Q151 I152 A153 R154 S155 A156 G157 Y169 L174 S176 E178 L196 H198 E199 N202 V203 G204 A206 R208 S209 R210 W211 R215 P216 T217 V218 R219 G220 S221 V222 M223 N224 P225 N226 D227 H230 G232 G233 E234 G235 R236 P238 I239 G240 R241 P242 P244 S246 P247 W248 T252 G254 K256 T257 R258 S264

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4wce, PDBe:4wce, PDBj:4wce
PDBsum	4wce
PubMed	26464510
UniProt	P60430\|RL2_STAA8 Large ribosomal subunit protein uL2 (Gene Name=rplB)

[Back to BioLiP]