Structure of PDB 4v4i Chain A

Receptor sequence
>4v4iA (length=127) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
KRYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRS
DQNVRGTVSIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKP
EGAKGTFLRSVYVTTTMGPSVRINPHS
3D structure
PDB4v4i Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements
ChainA
Resolution3.71 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A R7 K37 F38 T41 E43 H45 K47 K168 I172 H173 P175 K206 G207 T208 T216 T217 T218 M219 G220 P221 S222 R2 K32 F33 T36 E38 H40 K42 K66 I70 H71 P73 K104 G105 T106 T114 T115 T116 M117 G118 P119 S120
BS02 rna A R53 R54 R48 R49
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0006417 regulation of translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4i, PDBe:4v4i, PDBj:4v4i
PDBsum4v4i
PubMed16962654
UniProtQ5SLP7|RL1_THET8 Large ribosomal subunit protein uL1 (Gene Name=rplA)

[Back to BioLiP]