Structure of PDB 4v2k Chain A

Receptor sequence

>4v2kA (length=235) Species: 1049 (Allochromatium vinosum)

PTVALTVPAAALLPDGALGESIVRGRRYLSDTPAQLPDFVGNGLACRHCH
PGRDGEVGTEANAAPFVGVVGRFPQYSARHGRLITLEQRIGDCFERSLNG
RALALDHPALIDMLAYMSWLSQGVPVGAVVAGHGIPTLTLEREPDGVHGE
ALYQARCLACHGADGSGTLDADGRYLFPPLWGPRSFNTGAGMNRQATAAG
FIKHKMPLGADDSLSDEEAWDVAGFVLTHPRPLFQ

3D structure

• PDB: 4v2k Mechanism of Thiosulfate Oxidation in the Soxa Family of Cysteine-Ligated Cytochromes
• Chain: A
• Resolution: 1.29 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R109 R119 C123 S127
• Catalytic site (residue number reindexed from 1): R79 R89 C93 S97
• Enzyme Commision number: 1.8.2.2: thiosulfate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	H78 C79 P81 R186 C187 C190 H191 F207 P208 P209 L210 F216 F231 M236 P237 L238	H48 C49 P51 R156 C157 C160 H161 F177 P178 P179 L180 F186 F201 M206 P207 L208
BS02	HEC	A	C76 C79 H80 F96 C123 F124 S127 L128 G164 I165	C46 C49 H50 F66 C93 F94 S97 L98 G134 I135
BS03	THJ	A	R109 R119 C123 R126 S127 A220 G221	R79 R89 C93 R96 S97 A190 G191

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:0050338 thiosulfate dehydrogenase activity

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:4v2k, PDBe:4v2k, PDBj:4v2k
• PDBsum: 4v2k
• PubMed: 25673696
• UniProt: D3RVD4|TSDA_ALLVD Thiosulfate dehydrogenase (Gene Name=tsdA)