Structure of PDB 4v04 Chain A

Receptor sequence
>4v04A (length=292) Species: 9606 (Homo sapiens) [Search protein sequence]
YELPEDPRWELPRDRLVLGKPLGEGQVVLAEAIGLDKDKPNRVTKVAVKM
LKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYAS
KGNLREYLQARRPPGLEYSPSHNPEEQLSSKDLVSCAYQVARGMEYLASK
KCIHRDLAARNVLVTEDNVMKIADFGLIDYYKKTTNGRLPVKWMAPEALF
DRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPS
NCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQE
3D structure
PDB4v04 Structural Insights Into Fgfr Kinase Isoform Selectivity: Diverse Binding Modes of Azd4547 and Ponatinib in Complex with Fgfr1 and Fgfr4
ChainA
Resolution2.12 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 0LI A V492 A512 K514 E531 M534 V561 Y563 A564 L614 C619 I620 H621 R622 L630 I639 A640 D641 G643 L644 V27 A47 K49 E66 M69 V96 Y98 A99 L147 C152 I153 H154 R155 L163 I172 A173 D174 G176 L177 MOAD: Kd=7.7nM
PDBbind-CN: -logKd/Ki=8.11,Kd=7.7nM
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Thu Feb 20 18:16:57 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v04', asym_id = 'A', title = 'Structural Insights Into Fgfr Kinase Isoform Sel...47 and Ponatinib in Complex with Fgfr1 and Fgfr4 '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v04', asym_id='A', title='Structural Insights Into Fgfr Kinase Isoform Sel...47 and Ponatinib in Complex with Fgfr1 and Fgfr4 ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0004672,0004713,0005007,0005524,0006468', uniprot = '', pdbid = '4v04', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004672,0004713,0005007,0005524,0006468', uniprot='', pdbid='4v04', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>