Structure of PDB 4uyq Chain A |
>4uyqA (length=143) Species: 35830 (Acetivibrio cellulolyticus) [Search protein sequence] |
MLQVDIGSTSGKAGSVVSVPITFTNVPKSGIYALSFRTNFDPQKVTVASI DAGSLIENASDFTTYYNNENGFASMTFEAPVDRARIIDSDGVFATINFKV SDSAKVGELYNITTNSAYTSFYYSGTDEIKNVVYNDGKIEVIA |
|
PDB | 4uyq Cell-surface Attachment of Bacterial Multienzyme Complexes Involves Highly Dynamic Protein-Protein Anchors. |
Chain | A |
Resolution | 1.81 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
D5 I6 N135 D136 |
D5 I6 N135 D136 |
|
|
|
|