Structure of PDB 4uw3 Chain A |
>4uw3A (length=134) Species: 9606 (Homo sapiens) [Search protein sequence] |
NVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFN PRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVV GDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF |
|
PDB | 4uw3 Structural Basis of Multivalent Galactose-Based Dendrimer Recognition by Human Galectin-7. |
Chain | A |
Resolution | 1.479 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
50G |
A |
H49 R53 W69 E72 |
H48 R52 W68 E71 |
|
|
|
|