Structure of PDB 4uus Chain A

Receptor sequence
>4uusA (length=67) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
GRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALSLTERQIKIWFQNRR
MKLKKEIQAIKELNEQE
3D structure
PDB4uus A Flexible Extension of the Drosophila Ultrabithorax Homeodomain Defines a Novel Hox/Pbc Interaction Mode.
ChainA
Resolution2.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R5 Y25 R28 R31 K46 Q50 R53 M54 R2 Y22 R25 R28 K43 Q47 R50 M51
BS02 dna A R5 Q6 T7 Y8 Q44 I47 N51 K55 R2 Q3 T4 Y5 Q41 I44 N48 K52
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4uus, PDBe:4uus, PDBj:4uus
PDBsum4uus
PubMed25651060
UniProtP83949|UBX_DROME Homeotic protein ultrabithorax (Gene Name=Ubx)

[Back to BioLiP]