Structure of PDB 4usi Chain A

Receptor sequence

>4usiA (length=115) Species: 3055 (Chlamydomonas reinhardtii)

SIQCDLSAFPGVKFFRIEAIFRPWRLPFVIDTLSKYGIRGLTNTPVKGVG
VQGGSEFGPSNLVDKEKLDIVVSRAQVDAVVRLVAASAYTGEIGDGKIFV
HPVAEVVRIRTAETG

3D structure

• PDB: 4usi A Widespread Glutamine-Sensing Mechanism in the Plant Kingdom.
• Chain: A
• Resolution: 1.45 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ATP	A	G52 V53 G54 V55 Q56 I104 G105 G107 K108 F110	G48 V49 G50 V51 Q52 I93 G94 G96 K97 F99
BS02	AKG	A	V53 G54 Q56 G58 K76 G105	V49 G50 Q52 G54 K65 G94	MOAD: Kd=38.9uM PDBbind-CN: -logKd/Ki=4.41,Kd=38.9uM
BS03	ATP	A	G44 L45 T46 V82 R119 R121	G40 L41 T42 V71 R108 R110

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Dec 18 20:09:09 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4usi', asym_id = 'A', title = 'A Widespread Glutamine-Sensing Mechanism in the Plant Kingdom.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4usi', asym_id='A', title='A Widespread Glutamine-Sensing Mechanism in the Plant Kingdom.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0006808,0030234', uniprot = '', pdbid = '4usi', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006808,0030234', uniprot='', pdbid='4usi', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>