Structure of PDB 4url Chain A

Receptor sequence

>4urlA (length=364) Species: 1280 (Staphylococcus aureus)

EGLEAVRKRPGMYIGSTDKRGLHHLVYEIVDNSVDEVLNGYGNEIDVTIN
KDGSISIEDNGRGMPTGIHKSGKPTVEVIFTVLHAGHGVGASVVNALSEW
LEVEIHRDGNIYHQSFKNGGSPSSGLVKKGKTKKTGTKVTFKPDDTIFKA
STSFNFDVLSERLQESAFLLKNLKITLNDLRSGKERQEHYHYEEGIKEFV
SYVNEGKEVLHDVATFSGEANGIEVDVAFQYNDQYSESILSFVNNVRTKD
GGTHEVGFKTAMTRVFNDYARRINELKTDKNLDGNDIREGLTAVVSVRIP
EELLQFKSKLGTSEARSAVDSVVADKLPFYLEEKGQLSKSLVKKAIKAQQ
AREAARKAREDARS

3D structure

• PDB: 4url Structures of Kibdelomycin Bound to Staphylococcus Aureus Gyrb and Pare Showed a Novel U-Shaped Binding Mode.
• Chain: A
• Resolution: 2.29 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	XAM	A	I46 N49 E53 D76 R79 M81 H86 T92 I96 L100 H101 G103 T168	I29 N32 E36 D59 R62 M64 H69 T75 I79 L83 H84 G86 T137	MOAD: ic50=500nM PDBbind-CN: -logKd/Ki=6.30,IC50=500nM

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Nov 24 19:33:09 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4url', asym_id = 'A', title = 'Structures of Kibdelomycin Bound to Staphylococc...rb and Pare Showed a Novel U-Shaped Binding Mode.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4url', asym_id='A', title='Structures of Kibdelomycin Bound to Staphylococc...rb and Pare Showed a Novel U-Shaped Binding Mode.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003677,0003918,0005524,0006265', uniprot = '', pdbid = '4url', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0003918,0005524,0006265', uniprot='', pdbid='4url', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>