Structure of PDB 4uqq Chain A

Receptor sequence

>4uqqA (length=693) Species: 10116 (Rattus norvegicus) [Search protein sequence]

THVLRFGGIFEYVESGPMGAEELAFRFAVNTINRNRTLLPNTTLTYDTQK
INLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQT
RWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDSTGL
IRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSH
EMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRIL
NTENTQVSSIIEKWSMERLQAPPKPDSGLLDGFMTTDAALMYDAVHVVSV
AVQQFPQMTVSSLQCNRHKPWRFGTRFMSLIKEAHWEGLTGRITFNKTNG
LRTDFDLDVISLKEEGLEKIGTWDPASGLNMTENRSLIVTTILEEPYVLF
KKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNG
QWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGV
FSFLNPLSPDIWMYVLLACWFFTLIIISSYTANLAAFLTVERPIDSADDL
AKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEG
IQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPY
RDKITIAILQLQEEGKLHMMKEKWWRGNGCPEQNIGGIFIVLA

3D structure

PDB

4uqq Structural Mechanism of Glutamate Receptor Activation and Desensitization

Chain

Resolution

7.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GLU	A	Y457 P485 L486 A487 R492 G657 A658 T659 E707	Y442 P470 L471 A472 R477 G564 A565 T566 E614

Gene Ontology

	Molecular Function
GO:0000149	SNARE binding
GO:0004970	glutamate-gated receptor activity
GO:0005216	monoatomic ion channel activity
GO:0005234	extracellularly glutamate-gated ion channel activity
GO:0005515	protein binding
GO:0008066	glutamate receptor activity
GO:0015276	ligand-gated monoatomic ion channel activity
GO:0015277	kainate selective glutamate receptor activity
GO:0022849	glutamate-gated calcium ion channel activity
GO:0030165	PDZ domain binding
GO:0031624	ubiquitin conjugating enzyme binding
GO:0031625	ubiquitin protein ligase binding
GO:0038023	signaling receptor activity
GO:0042802	identical protein binding
GO:0097110	scaffold protein binding
GO:0099507	ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential
GO:1904315	transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential

	Biological Process
GO:0001662	behavioral fear response
GO:0006811	monoatomic ion transport
GO:0006874	intracellular calcium ion homeostasis
GO:0007268	chemical synaptic transmission
GO:0019228	neuronal action potential
GO:0019722	calcium-mediated signaling
GO:0034220	monoatomic ion transmembrane transport
GO:0035235	ionotropic glutamate receptor signaling pathway
GO:0035249	synaptic transmission, glutamatergic
GO:0042391	regulation of membrane potential
GO:0043113	receptor clustering
GO:0043524	negative regulation of neuron apoptotic process
GO:0043525	positive regulation of neuron apoptotic process
GO:0046328	regulation of JNK cascade
GO:0048169	regulation of long-term neuronal synaptic plasticity
GO:0048172	regulation of short-term neuronal synaptic plasticity
GO:0050804	modulation of chemical synaptic transmission
GO:0050806	positive regulation of synaptic transmission
GO:0051402	neuron apoptotic process
GO:0051967	negative regulation of synaptic transmission, glutamatergic
GO:0060079	excitatory postsynaptic potential
GO:0060080	inhibitory postsynaptic potential
GO:0098815	modulation of excitatory postsynaptic potential
GO:0099171	presynaptic modulation of chemical synaptic transmission
GO:0099505	regulation of presynaptic membrane potential
GO:0120169	detection of cold stimulus involved in thermoception

	Cellular Component
GO:0005886	plasma membrane
GO:0008328	ionotropic glutamate receptor complex
GO:0014069	postsynaptic density
GO:0016020	membrane
GO:0030424	axon
GO:0030425	dendrite
GO:0032839	dendrite cytoplasm
GO:0032983	kainate selective glutamate receptor complex
GO:0042734	presynaptic membrane
GO:0043025	neuronal cell body
GO:0043195	terminal bouton
GO:0043204	perikaryon
GO:0045202	synapse
GO:0045211	postsynaptic membrane
GO:0097471	mossy fiber rosette
GO:0098686	hippocampal mossy fiber to CA3 synapse
GO:0098839	postsynaptic density membrane
GO:0098978	glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4uqq, PDBe:4uqq, PDBj:4uqq
PDBsum	4uqq
PubMed	25119039
UniProt	P42260\|GRIK2_RAT Glutamate receptor ionotropic, kainate 2 (Gene Name=Grik2)

[Back to BioLiP]