Structure of PDB 4uno Chain A

Receptor sequence
>4unoA (length=95) Species: 9606 (Homo sapiens) [Search protein sequence]
SLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPA
MNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPD
3D structure
PDB4uno Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
ChainA
Resolution1.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A Y419 R424 R427 Y430 K437 R442 Y443 Y53 R58 R61 Y64 K71 R76 Y77
BS02 dna A Q369 L370 W408 K412 R414 M417 D420 K421 R424 S425 Y429 Q3 L4 W42 K46 R48 M51 D54 K55 R58 S59 Y63
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4uno, PDBe:4uno, PDBj:4uno
PDBsum4uno
PubMed25866208
UniProtP41161|ETV5_HUMAN ETS translocation variant 5 (Gene Name=ETV5)

[Back to BioLiP]