Structure of PDB 4umo Chain A

Receptor sequence
>4umoA (length=75) Species: 9606 (Homo sapiens) [Search protein sequence]
QQKQRQKHFNRQIPAAASLIQTAWRCYAAENPDSSTWKIYIEFSQLREHH
RATIKVIRRMQYFVAKKKFQQARKP
3D structure
PDB4umo Structural Basis of a Kv7.1 Potassium Channel Gating Module: Studies of the Intracellular C-Terminal Domain in Complex with Calmodulin
ChainA
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 K A W392 F398 R507 W37 F43 R47
BS02 K A Y395 E397 F398 Y40 E42 F43
BS03 K A R507 H510 R511 R47 H50 R51
Gene Ontology
Molecular Function
GO:0005249 voltage-gated potassium channel activity
Biological Process
GO:0006813 potassium ion transport
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4umo, PDBe:4umo, PDBj:4umo
PDBsum4umo
PubMed25441029
UniProtP51787|KCNQ1_HUMAN Potassium voltage-gated channel subfamily KQT member 1 (Gene Name=KCNQ1)

[Back to BioLiP]