Structure of PDB 4ufw Chain A

Receptor sequence

>4ufwA (length=385) Species: 5855 (Plasmodium vivax)

MDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYV
CDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTW
HIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLA
PVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIG
FSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQF
NLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGND
KYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSV
FEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL

3D structure

• PDB: 4ufw Discovery of Pyridyl-Based Inhibitors of Plasmodium Falciparum N-Myristoyltransferase
• Chain: A
• Resolution: 1.5 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): N161 F162 L163 T197 L410
• Catalytic site (residue number reindexed from 1): N136 F137 L138 T172 L385
• Enzyme Commision number: 2.3.1.97: glycylpeptide N-tetradecanoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NHW	A	Y28 F30 W31 Y95 V96 L163 C164 V165 R170 S171 R173 A175 P176 T183 I186 W192 Q193 A194 Y196 T197 A198 L202 Y393	Y3 F5 W6 Y70 V71 L138 C139 V140 R145 S146 R148 A150 P151 T158 I161 W167 Q168 A169 Y171 T172 A173 L177 Y368
BS02	7Y6	A	E97 D98 F103 F105 Y211 S319 Y334 N365 A366 L367 L388 L410	E72 D73 F78 F80 Y186 S294 Y309 N340 A341 L342 L363 L385
BS03	MG	A	R170 K172 L174	R145 K147 L149

Gene Ontology

Molecular Function

• GO:0004379 glycylpeptide N-tetradecanoyltransferase activity
• GO:0016746 acyltransferase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006499 N-terminal protein myristoylation
• GO:0018008 N-terminal peptidyl-glycine N-myristoylation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4ufw, PDBe:4ufw, PDBj:4ufw
• PDBsum: 4ufw
• PubMed: 26962430
• UniProt: A5K1A2