Structure of PDB 4uek Chain A

Receptor sequence

>4uekA (length=346) Species: 562 (Escherichia coli)

MKSVVNDTDGIVRVAESVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGA
HYYPITLGHEFSGYIDAVGSGVDDLHPGDAVACVPLLPCFTCPECLKGFY
SQCAKYDFIGSRRDGGFAEYIVVKRKNVFALPTDMPIEDGAFIEPITVGL
HAFHLAQGCENKNVIIIGAGTIGLLAIQCAVALGAKSVTAIDISSEKLAL
AKSFGAMQTFNSSEMSAPQMQSVLRELRFNQLILETAGVPQTVELAVEIA
GPHAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQEWE
TASRLLTERKLSLEPLIAHRGSFESFAQAVRDIARNAMPGKVLLIP

3D structure

• PDB: 4uek Enantioselective Oxidation of Galactitol 1-Phosphate by Galactitol-1-Phosphate 5-Dehydrogenase from Escherichia Coli
• Chain: A
• Resolution: 1.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C38 G39 S40 P43 H59 E60 C89 C92 C95 C103 D107 P145 G149 K341
• Catalytic site (residue number reindexed from 1): C38 G39 S40 P43 H59 E60 C89 C92 C95 C103 D107 P145 G149 K341
• Enzyme Commision number: 1.1.1.251: galactitol-1-phosphate 5-dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C38 H59	C38 H59
BS02	ZN	A	C89 C92 C95 C103	C89 C92 C95 C103

Gene Ontology

Molecular Function

• GO:0008270 zinc ion binding
• GO:0008868 galactitol-1-phosphate 5-dehydrogenase activity
• GO:0016491 oxidoreductase activity
• GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
• GO:0042802 identical protein binding
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding

Biological Process

• GO:0019402 galactitol metabolic process
• GO:0019404 galactitol catabolic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:4uek, PDBe:4uek, PDBj:4uek
• PDBsum: 4uek
• PubMed: 26143925
• UniProt: P0A9S3|GATD_ECOLI Galactitol 1-phosphate 5-dehydrogenase (Gene Name=gatD)