Structure of PDB 4u0m Chain A

Receptor sequence

>4u0mA (length=387) Species: 243277 (Vibrio cholerae O1 biovar El Tor str. N16961)

MTWNFHQYYTNRNDGLMGKLVLTDEEKNNLKALRKIIRLRTRDVFEEAKG
IAKAVKKSALTFEIIQEKVSTTQIKHLSDSEQREVAKLIYEMDDDARDEF
LGLTPRFWTQGSFQYDTLNRPFQPGQEMDIDDGTYMPMPIFESEPKIGHS
LLILLVDASLKSLVAENHGWKFEAKQTCGRIKIEAEKTHINVPMYAIPKD
EFQKKQIALEANRYELDSENVNLALREGDRKWINSDPKIVEDWFNDSCIR
IGKHLRKVCRFMKAWRDAQWDVGGPSSISLMAATVNILDSVAHDASDLGE
TMKIIAKHLPSEFARGVESPDSTDEKPLFPPSYKHGPREMDIMSKLERLP
EILSSAESADSKSEALKKINMAFGNRVTNSELIVLAK

3D structure

• PDB: 4u0m Structural Biochemistry of a Vibrio cholerae Dinucleotide Cyclase Reveals Cyclase Activity Regulation by Folates.
• Chain: A
• Resolution: 2.3 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GTP	A	Q112 G113 S114 Y117 D131 D133 K287 S301 D348	Q110 G111 S112 Y115 D129 D131 K263 S277 D324
BS02	ATP	A	D133 K177 R182 S259	D131 K175 R180 S235
BS03	MG	A	D131 D133	D129 D131
BS04	TLL	A	R36 R40 R108 F109 W110 Y137 F204 E239 L240 D260 K262	R34 R38 R106 F107 W108 Y135 F202 E215 L216 D236 K238	PDBbind-CN: -logKd/Ki=5.77,IC50=1.69uM

Gene Ontology

Molecular Function

• GO:0005524 ATP binding
• GO:0005525 GTP binding
• GO:0016779 nucleotidyltransferase activity
• GO:0046872 metal ion binding
• GO:0052621 diguanylate cyclase activity
• GO:0140701 3',3'-cyclic GMP-AMP synthase activity

Biological Process

• GO:0009117 nucleotide metabolic process
• GO:0009190 cyclic nucleotide biosynthetic process
• GO:0050922 negative regulation of chemotaxis
• GO:0051607 defense response to virus

Cellular Component

• GO:0005575 cellular_component

External links

• PDB: RCSB:4u0m, PDBe:4u0m, PDBj:4u0m
• PDBsum: 4u0m
• PubMed: 25201413
• UniProt: Q9KVG7|DNCV_VIBCH Cyclic GMP-AMP synthase (Gene Name=dncV)