Structure of PDB 4tz8 Chain A |
>4tz8A (length=130) Species: 9606 (Homo sapiens) [Search protein sequence] |
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQP MDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRA CALRDTAYAIIKEELDEDFEQLCEEIQESR |
|
PDB | 4tz8 Fragment-Based Screening of the Bromodomain of ATAD2. |
Chain | A |
Resolution | 2.15 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
39U |
A |
V1008 V1013 I1074 |
V30 V35 I96 |
MOAD: Kd=500uM PDBbind-CN: -logKd/Ki=3.30,Kd=500uM BindingDB: Kd=500000nM |
|
|