Structure of PDB 4twi Chain A

Receptor sequence
>4twiA (length=244) Species: 224325 (Archaeoglobus fulgidus DSM 4304) [Search protein sequence]
DEKLLKTIAESKYLVALTGAGVSAESGIPTFRGKDGLWNRYRPEELANPQ
AFAKDPEKVWKWYAWRMEKVFNAQPNKAHQAFAELERLGVLKCLITQNVD
DLHERAGSRNVIHLHGSLRVVRCTSCNNSFEVESAPKIPPLPKCDKCGSL
LRPGVVWFGEMLPPDVLDRAMREVERADVIIVAGTSAVVQPAASLPLIVK
QRGGAIIEINPDETPLTPIADYSLRGKAGEVMDELVRHVRKALS
3D structure
PDB4twi Alternate deacylating specificities of the archaeal sirtuins Sir2Af1 and Sir2Af2.
ChainA
Resolution1.79 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) P30 T31 F32 R33 N99 D101 H116
Catalytic site (residue number reindexed from 1) P29 T30 F31 R32 N98 D100 H115
Enzyme Commision number 2.3.1.286: protein acetyllysine N-acetyltransferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A Y64 R67 V100 H116 V157 F159 G160 E161 M162 V189 V190 Q191 P192 S195 Y63 R66 V99 H115 V156 F158 G159 E160 M161 V188 V189 Q190 P191 S194
BS02 ZN A C124 C127 C145 C148 C123 C126 C144 C147
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0016740 transferase activity
GO:0017136 NAD-dependent histone deacetylase activity
GO:0034979 NAD-dependent protein lysine deacetylase activity
GO:0036054 protein-malonyllysine demalonylase activity
GO:0036055 protein-succinyllysine desuccinylase activity
GO:0046872 metal ion binding
GO:0070403 NAD+ binding
Biological Process
GO:0006338 chromatin remodeling
GO:0006476 protein deacetylation
GO:0036048 protein desuccinylation
GO:0036049 peptidyl-lysine desuccinylation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4twi, PDBe:4twi, PDBj:4twi
PDBsum4twi
PubMed25200501
UniProtO28597|NPD1_ARCFU NAD-dependent protein deacylase 1 (Gene Name=cobB1)

[Back to BioLiP]