Structure of PDB 4tvh Chain A

Receptor sequence

>4tvhA (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence]

PQITLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGI
GGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

3D structure

PDB

4tvh Distinguishing Binders from False Positives by Free Energy Calculations: Fragment Screening Against the Flap Site of HIV Protease.

Chain

Resolution

2.195 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

Enzymatic activity

Catalytic site (original residue number in PDB)	D25 T26 G27
Catalytic site (residue number reindexed from 1)	D25 T26 G27
Enzyme Commision number	?

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	3TL	A	D25 G27 A28 D29 I47 G48 G49 I50 P81 I84	D25 G27 A28 D29 I47 G48 G49 I50 P81 I84

Gene Ontology

	Molecular Function
GO:0004190	aspartic-type endopeptidase activity

	Biological Process
GO:0006508	proteolysis

External links