Structure of PDB 4tt5 Chain A

Receptor sequence

>4tt5A (length=367) Species: 330779 (Sulfolobus acidocaldarius DSM 639)

MYDWFSEMRKKDPVYYDGNIWQVFSYRYTKEVLNNFSKFSSDLTGYHERL
EDLRNGKIRFDIPTRYTMLTSDPPLHDELRSMSADIFSPQKLQTLETFIR
ETTRSLLDSIDPREDDIVKKLAVPLPIIVISKILGLPIEDKEKFKEWSDL
VAFRLGKPGEIFELGKKYLELIGYVKDHLNSGTEVVSRVVNSNLSDIEKL
GYIILLLIAGNETTTNLISNSVIDFTRFNLWQRIREENLYLKAIEEALRY
SPPVMRTVRKTKERVKLGDQTIEEGEYVRVWIASANRDEEVFHDGEKFIP
DRNPNPHLSFGSGIHLCLGAPLARLEARIAIEEFSKRFRHIEILDTEKVP
NEVLNGYKRLVVRLKSN

3D structure

• PDB: 4tt5 NMR and X-ray Analysis of CYP119 ligand-dependent conformational changes
• Chain: A
• Resolution: 2.18 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): F153 A209 E212 T213 T214 C317 L318 G319 E326 L354
• Catalytic site (residue number reindexed from 1): F153 A209 E212 T213 T214 C317 L318 G319 E326 L354
• Enzyme Commision number: 1.11.1.7: peroxidase.
  1.14.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	M68 L69 H76 R80 G210 T213 L217 P253 T257 R259 S309 F310 H315 C317 L318 G319 A323	M68 L69 H76 R80 G210 T213 L217 P253 T257 R259 S309 F310 H315 C317 L318 G319 A323
BS02	36Y	A	V151 F153 A209 V353	V151 F153 A209 V353

Gene Ontology

Molecular Function

• GO:0004497 monooxygenase activity
• GO:0004601 peroxidase activity
• GO:0005506 iron ion binding
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:0140825 lactoperoxidase activity

Biological Process

• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4tt5, PDBe:4tt5, PDBj:4tt5
• PDBsum: 4tt5
• UniProt: Q55080|CP119_SULAC Cytochrome P450 119 (Gene Name=cyp119)