Structure of PDB 4tso Chain A

Receptor sequence
>4tsoA (length=177) Species: 396334 (Actinia fragacea) [Search protein sequence]
DVAGAVIDGAGLGFDVLKTVLEALGNVKRKIAVGIDNESGKTWTAMNTYF
RSGTSDIVLPHKVAHGKALLYNGQKNRGPVATGVVGVIAYSMSDGNTLAV
LFSVPYDYNWYSNWWNVRVYKGQKRADQRMYEELYYHRSPFRGDNGWHSR
GLGYGLKSRGFMNSSGHAILEIHVTKA
3D structure
PDB4tso Structural basis for self-assembly of a cytolytic pore lined by protein and lipid
ChainA
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HXG A W112 Y113 W116 Y137 W110 Y111 W114 Y135
BS02 HXG A S54 A83 G85 P107 D109 Y113 Y133 Y137 S52 A81 G83 P105 D107 Y111 Y131 Y135
BS03 HXG A R53 Y133 E134 Y138 R51 Y131 E132 Y136
Gene Ontology
Molecular Function
GO:0008289 lipid binding
GO:0015267 channel activity
GO:0042802 identical protein binding
GO:0090729 toxin activity
Biological Process
GO:0006811 monoatomic ion transport
GO:0006812 monoatomic cation transport
GO:0031640 killing of cells of another organism
GO:0035821 modulation of process of another organism
GO:0046931 pore complex assembly
GO:0051715 cytolysis in another organism
GO:0055085 transmembrane transport
Cellular Component
GO:0005576 extracellular region
GO:0016020 membrane
GO:0042151 nematocyst
GO:0044218 other organism cell membrane
GO:0046930 pore complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4tso, PDBe:4tso, PDBj:4tso
PDBsum4tso
PubMed25716479
UniProtB9W5G6|ACTPC_ACTFR DELTA-actitoxin-Afr1a

[Back to BioLiP]